Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0634900_circ_g.1 |
| ID in PlantcircBase | osa_circ_015720 |
| Alias | Os_ciR7931 |
| Organism | Oryza sativa |
| Position | chr2: 25455515-25456750 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os02g0634900 |
| Parent gene annotation |
Proteasome subunit alpha type 2 (EC 3.4.25.1) (20S proteasome al pha subunit B) (20S proteasome subunit alpha-2). (Os02t0634900-0 1) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os02t0634900-01:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.132845044 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
25456434-25455518(+) |
| Potential amino acid sequence |
MGPDFRVLVRKSRKQAQQYYRLYKETIPVTQLVRETAAVMQEFTQSGC*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |