Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT4G20850_circ_g.2 |
ID in PlantcircBase | ath_circ_031892 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr4: 11161542-11161634 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | AT4G20850 |
Parent gene annotation |
Tripeptidyl-peptidase 2 |
Parent gene strand | - |
Alternative splicing | AT4G20850_circ_g.1 AT4G20850_circ_g.3 AT4G20850_circ_g.4 |
Support reads | 10 |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT4G20850.1:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.230282891 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
11161620-11161544(-) |
Potential amino acid sequence |
MEVTRDQLADALYQKGLAMARIENLKKLKKKMEVTRDQLADALYQKGLAMARIENLKKLKKKME VTRDQLADALYQKGLAMARIENLKKLKKKMEVTRDQLADALYQKGLAMARIENLK(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |