Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.006G074300_circ_g.2 |
| ID in PlantcircBase | gra_circ_000586 |
| Alias | Chr06:29545968|29546785 |
| Organism | Gossypium raimondii |
| Position | chrChr06: 29545968-29546785 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.006G074300 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | orai.006G074300_circ_g.1 |
| Support reads | 2 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.006G074300.1:3 Gorai.006G074300.2:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.155462215 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
29546783-29546757(-) 29546742-29545986(+) |
| Potential amino acid sequence |
MEEVEKNFVTMRCMLSGDGEVEPNVEQVSQLALEISKEDVISLVVHKLPILGWEARKDLVHCWS ILLKQQVDSKYCCVEYIEKHLELLDFLVVCYDNKEIALNCGNMLRECIKFPSLAQLWKKLRKIL *(-) MHLIVTKFFSTSSIAVQVMEI*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |