Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.003G181400_circ_g.1 |
| ID in PlantcircBase | gra_circ_000295 |
| Alias | Chr03:45315368|45316050 |
| Organism | Gossypium raimondii |
| Position | chrChr03: 45315368-45316050 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | ue-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.003G181400 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 13 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Gorai.003G181400.2:3 Gorai.003G181400.3:3 Gorai.003G181400.1:3 Gorai.003G181400.4:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 1.02092849 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
45315443-45316017(-) 45315748-45316025(-) |
| Potential amino acid sequence |
MSQTISSSTATKLIAIDAQRERIKINSIALVSWLMV*(-) MQGCLSAVSIQKSGPPFSLSSRPSFTKASTPTPVIAEFSSLAIKTATTVDSSFGFVSASLFISS VTSATCPKQSVVPRPRSLSPSMLNEKGSKSIPLRWFHG*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |