Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0617900_circ_g.3 |
| ID in PlantcircBase | osa_circ_002667 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 24573707-24574159 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, KNIFE, PcircRNA_finder |
| Parent gene | Os01g0617900 |
| Parent gene annotation |
Similar to oxygen-evolving complex-related. (Os01t0617900-01);Si milar to predicted protein. (Os01t0617900-02);Similar to oxygen- evolving complex-related. (Os01t0617900-03) |
| Parent gene strand | + |
| Alternative splicing | Os01g0617900_circ_g.2 Os01g0617900_circ_g.4 |
| Support reads | 1 |
| Tissues | shoot, seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0617900-01:3 Os01t0617900-03:3 Os01t0617900-02:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.147731089 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
24573728-24573739(+) 24573716-24573788(-) |
| Potential amino acid sequence |
MDEDVKMATLVDPINAYSFLYPVELPGKKFTFKWVESRKPERYSSAAPLSPDARQRIVSERVDM IHNVVISVSIRMLLPRWMKM*(+) MRIETEMTTLCIMSTRSDTIRCRASGDSGAAEEYRSGFLDSTHLNVNFFPGNSTG*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |