Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0564600_circ_g.2 |
| ID in PlantcircBase | osa_circ_034313 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr7: 22629071-22631555 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os07g0564600 |
| Parent gene annotation |
Similar to Secretory carrier membrane protein. (Os07t0564600-01) ;Similar to Secretory carrier membrane protein. (Os07t0564600-02 ) |
| Parent gene strand | - |
| Alternative splicing | Os07g0564600_circ_g.1 Os07g0564600_circ_g.3 Os07g0564600_circ_g.4 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os07t0564600-02:9 Os07t0564600-01:9 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.110752126 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
22631500-22631126(-) |
| Potential amino acid sequence |
MPNPRNVPSVSSNSRLSPLPPEPAAFGATVDIPLDSSKDLKNREKELQAREAELNKREKELKRR EEAAARAGIVIEEKNWPPFLPLIHHDITNEIPSHLQRMQYVAFASFLGLACCLFWNVIAVTSAW VKGEGVKIWLLAIIYFISGVPGAYVLWYRPLYNAMRTDSALKFGLFFLVYLFHILFCVFSAVAP PVVFEGKSLANKRVVRLEGSPAMAAARSTCRIHGMCLLCRRIRGFRLFPLSPQLLGLRWISLLT LPRT*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |