Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os10g0477800_circ_g.1 |
| ID in PlantcircBase | osa_circ_007129 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr10: 17859281-17861910 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder |
| Parent gene | Os10g0477800 |
| Parent gene annotation |
Similar to Nuclear transportin. (Os10t0477800-01);Similar to Imp ortin-beta N-terminal domain containing protein. (Os10t0477800-0 2) |
| Parent gene strand | + |
| Alternative splicing | Os10g0477800_circ_g.2 Os10g0477800_circ_g.3 Os10g0477800_circ_g.4 Os10g0477800_circ_g.5 |
| Support reads | 2 |
| Tissues | root, seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os10t0477800-02:4 Os10t0477800-01:6 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_008518 |
| PMCS | 0.104661999 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
17859318-17859281(+) |
| Potential amino acid sequence |
METQIFCSQTLRSKVQRDFEELPSEAFRPLQDSLYALLKKFSKGPQKVRTQICIAMAALAVHVP VEDWGGGGIVNWLSDEMNSQQDFIPSFLELLTVLPQECSSHKIAARPERRRQFENDLRSSAEVA LSLLTACLGIDQLKEQVLEGFASWLRFCHG*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |