Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0136900_circ_g.5 |
| ID in PlantcircBase | osa_circ_017818 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 2029874-2030464 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os03g0136900 |
| Parent gene annotation |
Similar to Aconitate hydratase, cytoplasmic (EC 4.2.1.3) (Citrat e hydro-lyase) (Aconitase). (Os03t0136900-01);Similar to Aconita te hydratase 2, mitochondrial. (Os03t0136900-02) |
| Parent gene strand | - |
| Alternative splicing | Os03g0136900_circ_g.6 Os03g0136900_circ_g.7 Os03g0136900_circ_g.8 Os03g0136900_circ_g.9 Os03g0136900_circ_g.10 Os03g0136900_circ_g.11 Os03g0136900_circ_g.12 Os03g0136900_circ_g.13 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0136900-01:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.256294924 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
2030458-2030455(-) |
| Potential amino acid sequence |
MSELSLADRATIANMSPEYGATMGFFPVDGKTLDYLKLTGRSDDTVAMIESYLRANKMFVDYNQ PEAERVYSSYLELNLEEVEPCLSGPKRPHDRVTLKNMKSDWLSCLDNDVGFKGEA*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |