Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Solyc02g086670.2_circ_g.1 |
| ID in PlantcircBase | sly_circ_000776 |
| Alias | 2:43898492|43899065 |
| Organism | Solanum lycopersicum |
| Position | chr2: 49320642-49321215 JBrowse» |
| Reference genome | SL2.50.38 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Solyc02g086670.2 |
| Parent gene annotation |
protein_coding |
| Parent gene strand | - |
| Alternative splicing | Solyc02g086670.2_circ_g.2 Solyc02g086670.2_circ_g.3 |
| Support reads | 11 |
| Tissues | fruit |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Solyc02g086670.2.1:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.406385448 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
49321181-49321195(-) 49320718-49321195(-) |
| Potential amino acid sequence |
MNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVIRLLQYSPNLRCTALEALGHAFFDELRDPN ARPPNGRPLPSLFNFRPQGSWNTNS*(-) MSSVTLMLVLLMVVHCHLSSTSDLKVLGTPTREEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMP PEAVDLVIRLLQYSPNLRCTALEALGHAFFDELRDPNARPPNGRPLPSLFNFRPQGSWNTNS*( -) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | fruit ripening |
| Other Information | |
|---|---|
| References | Yin et al., 2018 |