Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT4G25550_circ_g.1 |
ID in PlantcircBase | ath_circ_032774 |
Alias | Ath_circ_FC2809 |
Organism | Arabidpsis thaliana |
Position | chr4: 13049850-13050524 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | AT4G25550 |
Parent gene annotation |
Pre-mRNA cleavage factor Im 25 kDa subunit 2 |
Parent gene strand | + |
Alternative splicing | AT4G25550_circ_g.2 AT4G25550_circ_g.3 |
Support reads | 14 |
Tissues | inflorescences, whole_plant |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT4G25550.1:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.216201587 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
13050483-13050521(+) |
Potential amino acid sequence |
MMYPYCPPHITKPKVQEHNHPHILLLQIGNTFCKLPGGRLKPGENEADGLKRKLTSKLGGNSAA LVPDWTVGECVATWWRPNFETMMYPYCPPHITKPKVQEHNHPHILLLQIGNTFCKLPGGRLKPG ENEADGLKRKLTSKLGGNSAALVPDWTVGECVATWWRPNFETMMYPYCPPHITKPKVQEHNHPH ILLLQIGNTFCKLPGGRLKPGENEADGLKRKLTSKLGGNSAALVPDWTVGECVATWWRPNFETM MYPYCPPHITKPK(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017;Chen et al., 2017a |