Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT4G25550_circ_g.1 |
| ID in PlantcircBase | ath_circ_032774 |
| Alias | Ath_circ_FC2809 |
| Organism | Arabidpsis thaliana |
| Position | chr4: 13049850-13050524 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | AT4G25550 |
| Parent gene annotation |
Pre-mRNA cleavage factor Im 25 kDa subunit 2 |
| Parent gene strand | + |
| Alternative splicing | AT4G25550_circ_g.2 AT4G25550_circ_g.3 |
| Support reads | 14 |
| Tissues | inflorescences, whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT4G25550.1:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.216201587 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
13050483-13050521(+) |
| Potential amino acid sequence |
MMYPYCPPHITKPKVQEHNHPHILLLQIGNTFCKLPGGRLKPGENEADGLKRKLTSKLGGNSAA LVPDWTVGECVATWWRPNFETMMYPYCPPHITKPKVQEHNHPHILLLQIGNTFCKLPGGRLKPG ENEADGLKRKLTSKLGGNSAALVPDWTVGECVATWWRPNFETMMYPYCPPHITKPKVQEHNHPH ILLLQIGNTFCKLPGGRLKPGENEADGLKRKLTSKLGGNSAALVPDWTVGECVATWWRPNFETM MYPYCPPHITKPK(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017;Chen et al., 2017a |