Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0701600_circ_g.1 |
ID in PlantcircBase | osa_circ_016117 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 28895639-28896073 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os02g0701600 |
Parent gene annotation |
Similar to Tocopherol O-methyltransferase, chloroplast precursor (EC 2.1.1.95) (Gamma-tocopherol methyltransferase). (Os02t07016 00-01) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os02t0701600-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | zma_circ_002131 |
PMCS | 0.174767318 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
28895775-28895639(+) 28896039-28895665(+) 28895689-28895743(-) |
Potential amino acid sequence |
MPSRQSKGYQTRSPFKLVMHWSSLFLMGSLILSGPWRVASTCQTNGR*(+) MESGEHMPDKRQMMRRRNPKV*(+) MPQPTSTTLLGFFSASSAVCLACARHSPWTRQDQTAHQEKAAPMHHQLERRPCLITLALPRGHF LFQPAPDST*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |