Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0701600_circ_g.1 |
| ID in PlantcircBase | osa_circ_016117 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 28895639-28896073 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os02g0701600 |
| Parent gene annotation |
Similar to Tocopherol O-methyltransferase, chloroplast precursor (EC 2.1.1.95) (Gamma-tocopherol methyltransferase). (Os02t07016 00-01) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os02t0701600-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | zma_circ_002131 |
| PMCS | 0.174767318 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
28895775-28895639(+) 28896039-28895665(+) 28895689-28895743(-) |
| Potential amino acid sequence |
MPSRQSKGYQTRSPFKLVMHWSSLFLMGSLILSGPWRVASTCQTNGR*(+) MESGEHMPDKRQMMRRRNPKV*(+) MPQPTSTTLLGFFSASSAVCLACARHSPWTRQDQTAHQEKAAPMHHQLERRPCLITLALPRGHF LFQPAPDST*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |