Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os06g0233400_circ_g.4 |
ID in PlantcircBase | osa_circ_030313 |
Alias | Os_ciR10788 |
Organism | Oryza sativa |
Position | chr6: 6929404-6931039 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os06g0233400 |
Parent gene annotation |
Defective in cullin neddylation domain containing protein. (Os06 t0233400-01);Defective in cullin neddylation domain containing p rotein. (Os06t0233400-02) |
Parent gene strand | - |
Alternative splicing | Os06g0233400_circ_g.1 Os06g0233400_circ_g.2 Os06g0233400_circ_g.3 Os06g0233400_circ_g.5 Os06g0233400_circ_g.6 Os06g0233400_circ_g.7 |
Support reads | 2/2 |
Tissues | root/root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os06t0233400-02:6 Os06t0233400-01:6 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.117227104 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
6929876-6931035(-) 6931027-6931024(-) |
Potential amino acid sequence |
MTINSVRYTTLLLLGLGKRVKNLSHWRLLLECGSCSLLKGTGPLSTIGASFYRT*(-) MIMVEGVSQFCTDLQVDPQDIVMLVISWHMKAATMCEFTRQEFIGGLQSIGVDSIEKLREKLPS LRAEIKDDHKFREIYNFAFAWAREKGQKSLALETALGMWQLLFAERHWPLIDHWCQFLQNLMLI *(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |