Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os05g0258400_circ_g.2 |
ID in PlantcircBase | osa_circ_027193 |
Alias | NA |
Organism | Oryza sativa |
Position | chr5: 9650591-9651486 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os05g0258400 |
Parent gene annotation |
Protein kinase, catalytic domain domain containing protein. (Os0 5t0258400-00) |
Parent gene strand | + |
Alternative splicing | Os05g0256500_circ_igg.1 Os05g0257100_circ_g.1 Os05g0257100_circ_ag.1 Os05g0258400_circ_igg.1 Os05g0258400_circ_g.1 Os05g0258400_circ_g.3 Os05g0258400_circ_g.4 Os05g0258400_circ_g.5 Os05g0258400_circ_igg.6 Os05g0258400_circ_g.7 Os05g0258400_circ_igg.8 Os05g0258400_circ_igg.9 Os05g0258400_circ_igg.10 Os05g0258400_circ_ig.1 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os05t0258400-00:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.108935658 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
9650800-9651483(+) 9650598-9650788(-) |
Potential amino acid sequence |
MPKLEDIILRNCKISGNLAPVDFSKFGVLTLLYIDSCGFSGPFPSTFSKLQNLKILRSSDNDFT GKIPDYLGIMPKLEDIILRNCKISGNLAPVDFSKFGVLTLLYIDSCGFSGPFPSTFSKLQNLKI LRSSDNDFTGKIPDYLGIMPKLEDIILRNCKISGNLAPVDFSKFGVLTLLYIDSCGFSGPFPST FSKLQNLKILRSSDNDFTGKIPDYLGIMPKLEDIILRNCKISGNLAPVDFSKFGVLTL(+) MYSRVKTPNFEKSTGARLPDILQFLNIISSNLGMIPK*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |