Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0923600_circ_g.1 |
ID in PlantcircBase | osa_circ_005558 |
Alias | Os_ciR6393 |
Organism | Oryza sativa |
Position | chr1: 40398334-40398449 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | Os01g0923600 |
Parent gene annotation |
Hypothetical conserved gene. (Os01t0923600-01);Ankyrin domain co ntaining protein. (Os01t0923600-02);Hypothetical conserved gene. (Os01t0923600-03) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os01t0923600-02:1 Os01t0923600-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.215514655 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
40398383-40398358(+) 40398439-40398447(-) |
Potential amino acid sequence |
MMGMNGEKRRMGRLLLKPMSALRWCLVSFQP*(+) MGFSNSLPILLFSPFIPIISEVPKNSTVEKKPSTTLRRSWASAIVFPFFFFRHSYPSFLKYRRT LRLKRNQAPP*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |