Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0923600_circ_g.1 |
| ID in PlantcircBase | osa_circ_005558 |
| Alias | Os_ciR6393 |
| Organism | Oryza sativa |
| Position | chr1: 40398334-40398449 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os01g0923600 |
| Parent gene annotation |
Hypothetical conserved gene. (Os01t0923600-01);Ankyrin domain co ntaining protein. (Os01t0923600-02);Hypothetical conserved gene. (Os01t0923600-03) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0923600-02:1 Os01t0923600-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.215514655 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
40398383-40398358(+) 40398439-40398447(-) |
| Potential amino acid sequence |
MMGMNGEKRRMGRLLLKPMSALRWCLVSFQP*(+) MGFSNSLPILLFSPFIPIISEVPKNSTVEKKPSTTLRRSWASAIVFPFFFFRHSYPSFLKYRRT LRLKRNQAPP*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |