Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT1G22275_circ_g.3 |
ID in PlantcircBase | ath_circ_003875 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr1: 7870830-7871330 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, KNIFE, PcircRNA_finder, circRNA_finder |
Parent gene | AT1G22275 |
Parent gene annotation |
Synaptonemal complex protein 2 |
Parent gene strand | + |
Alternative splicing | AT1G22275_circ_g.2 |
Support reads | 4 |
Tissues | leaf, aerial, whole_plant |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT1G22275.2:3 AT1G22275.1:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.186803462 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
7870872-7871327(+) |
Potential amino acid sequence |
MSDNPPEEQEVNSNKDYSHSSVKVKESRLGGNKRSEHITESPFVKAKVTSVSNILKEATNPKHH SKEERQRALVQLQWKVMSDNPPEEQEVNSNKDYSHSSVKVKESRLGGNKRSEHITESPFVKAKV TSVSNILKEATNPKHHSKEERQRALVQLQWKVMSDNPPEEQEVNSNKDYSHSSVKVKESRLGGN KRSEHITESPFVKAKVTSVSNILKEATNPKHHSKEERQRALVQLQWKVMSDNPPEEQEVNSNKD YSHSSVKVKESRLGGNKRSEHITESPFVKAKVTSVSNILKEATNPKHHSK(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |