Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT1G22275_circ_g.3 |
| ID in PlantcircBase | ath_circ_003875 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr1: 7870830-7871330 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, KNIFE, PcircRNA_finder, circRNA_finder |
| Parent gene | AT1G22275 |
| Parent gene annotation |
Synaptonemal complex protein 2 |
| Parent gene strand | + |
| Alternative splicing | AT1G22275_circ_g.2 |
| Support reads | 4 |
| Tissues | leaf, aerial, whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT1G22275.2:3 AT1G22275.1:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.186803462 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
7870872-7871327(+) |
| Potential amino acid sequence |
MSDNPPEEQEVNSNKDYSHSSVKVKESRLGGNKRSEHITESPFVKAKVTSVSNILKEATNPKHH SKEERQRALVQLQWKVMSDNPPEEQEVNSNKDYSHSSVKVKESRLGGNKRSEHITESPFVKAKV TSVSNILKEATNPKHHSKEERQRALVQLQWKVMSDNPPEEQEVNSNKDYSHSSVKVKESRLGGN KRSEHITESPFVKAKVTSVSNILKEATNPKHHSKEERQRALVQLQWKVMSDNPPEEQEVNSNKD YSHSSVKVKESRLGGNKRSEHITESPFVKAKVTSVSNILKEATNPKHHSK(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |