Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0163400_circ_g.1 |
| ID in PlantcircBase | osa_circ_036026 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr8: 3733794-3733992 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os08g0163400 |
| Parent gene annotation |
RNA polymerase sigma-70 domain containing protein. (Os08t0163400 -01);Similar to Plastid RNA polymerase sigma factor. (Os08t01634 00-02) |
| Parent gene strand | + |
| Alternative splicing | Os08g0163400_circ_g.2 Os08g0163400_circ_g.3 Os08g0163400_circ_g.4 Os08g0163400_circ_g.5 Os08g0163400_circ_g.6 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os08t0163400-02:1 Os08t0163400-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.220552429 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
3733880-3733814(+) 3733956-3733814(+) 3733990-3733911(-) |
| Potential amino acid sequence |
MHESFLAREMLTMSNLRLVISIAQKYDNLGVELADLIQAEREAGK*(+) MITLVLSWLTSFRLKEKLGNEPSYKQLAHSLKISPPELRSRMHESFLAREMLTMSNLRLVISIA QKYDNLGVELADLIQAEREAGK*(+) MRSANSTPRLSYFWAMEMTKRRLLIVSISLARNDSCILDRSSGGDIFSECASCLYEGSFPSFSF SLNEVSQLNTKVIILLGNGNDQTEVAHC*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |