Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT3G55400_circ_g.1 |
| ID in PlantcircBase | ath_circ_027631 |
| Alias | At_ciR1814 |
| Organism | Arabidpsis thaliana |
| Position | chr3: 20537517-20537910 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | find_circ, CIRI-full |
| Parent gene | AT3G55400 |
| Parent gene annotation |
Methionine--tRNA ligase, chloroplastic/mitochondrial |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 5 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT3G55400.1:2 AT3G55400.2:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.159688008 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
20537534-20537907(+) |
| Potential amino acid sequence |
MKQASQMKQQFLDFVVCCPLLELICNQVEHQTKHIWFAYRRREQEFPNPLMLEKWKNLLSHSLS NFVPFRSNAMKQASQMKQQFLDFVVCCPLLELICNQVEHQTKHIWFAYRRREQEFPNPLMLEKW KNLLSHSLSNFVPFRSNAMKQASQMKQQFLDFVVCCPLLELICNQVEHQTKHIWFAYRRREQEF PNPLMLEKWKNLLSHSLSNFVPFRSNAMKQASQMKQQFLDFVVCCPLLELICNQVEHQTKHIWF AYRRREQEFPNPLMLEKWKNLLSHSLSNFV(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |