Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os08g0492400_circ_g.6 |
ID in PlantcircBase | osa_circ_037476 |
Alias | NA |
Organism | Oryza sativa |
Position | chr8: 24329389-24330555 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os08g0492400 |
Parent gene annotation |
C2 calcium-dependent membrane targeting domain containing protei n. (Os08t0492400-01) |
Parent gene strand | + |
Alternative splicing | Os08g0492400_circ_g.1 Os08g0492400_circ_g.2 Os08g0492400_circ_g.3 Os08g0492400_circ_g.4 Os08g0492400_circ_g.5 Os08g0492400_circ_g.7 |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os08t0492400-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_018016 |
PMCS | 0.410118452 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
24329410-24329395(+) 24329465-24330453(-) |
Potential amino acid sequence |
MDDPPSVMNVHVYDFDGPFDEVTSLGHAEINFVKSNLSELADVWIPLQGNLAQSWQSKLHLRIF LSNSKGSTMVTEYLSKMEKEVGKKMTLRSPRTNTAFQELFSLPAEEFLISSFTCCLKRKLHTQG HLFLSPRTIGFYSSMFGRKTKFFFLWEDIEEIQAVPQSISSWSPSLVITLHKGRGMDAKHGAKS VDNGRLKFCLQSFASFSVANRHL*(+) MVHQNHIHVHSSLMVDHPWHQIQRCLLATLNDAKDCRQNFSLPLSTLFAPCFASMPLPL*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |