Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d030127_circ_g.3 |
| ID in PlantcircBase | zma_circ_006590 |
| Alias | zma_circ_0000222 |
| Organism | Zea mays |
| Position | chr1: 107763648-107764248 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Zm00001d030127 |
| Parent gene annotation |
Plastidal glycolate/glycerate translocator 1 chloroplastic |
| Parent gene strand | - |
| Alternative splicing | Zm00001d030127_circ_g.4 Zm00001d030127_circ_g.5 |
| Support reads | NA |
| Tissues | leaf, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Zm00001d030127_T001:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.089159664 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
107764211-107763686(+) 107763979-107764177(-) |
| Potential amino acid sequence |
MIGCSTFLTPGGNLQRKTLCSKPAPE*(+) MTFLGSVIISFAFSIFKQRKLVKRHATEIFTSIAIASTFSLYSTAIIGRLIGLEPSLTISILPR CITLALALSIVSFFEGYHLASRKCCIRSSPAHSVQISRR*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ma et al., 2021b |