Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0623550_circ_g.2 |
| ID in PlantcircBase | osa_circ_025378 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr4: 31690851-31691159 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os04g0623550 |
| Parent gene annotation |
Hypothetical gene. (Os04t0623550-01) |
| Parent gene strand | - |
| Alternative splicing | Os04g0623550_circ_ag.1 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os04t0623500-01:2 Os04t0623500-02:2 Os04t0623550-01:1 Os04t0623500-01:2 Os04t0623500-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.170712244 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
31691152-31691156(+) |
| Potential amino acid sequence |
MDKVYKDRNIVRQLVRRAELAGFKAIALTVDTPRLGRREADIKNRFNLPPHLVLKNFEALDLGK MDKVYKDRNIVRQLVRRAELAGFKAIALTVDTPRLGRREADIKNRFNLPPHLVLKNFEALDLGK MDKVYKDRNIVRQLVRRAELAGFKAIALTVDTPRLGRREADIKNRFNLPPHLVLKNFEALDLGK MDK(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |