Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os05g0454500_circ_g.1 |
ID in PlantcircBase | osa_circ_028115 |
Alias | NA |
Organism | Oryza sativa |
Position | chr5: 22304904-22305776 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os05g0454500 |
Parent gene annotation |
Conserved hypothetical protein. (Os05t0454500-01) |
Parent gene strand | - |
Alternative splicing | Os05g0454500_circ_g.2 Os05g0454500_circ_g.3 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os05t0454500-01:4 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_015545 |
PMCS | 0.114871697 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
22305708-22305334(-) |
Potential amino acid sequence |
MAVALQMANRTALLKLVVHTRMVNNHIQTSHRSRHILALLCITVLGSFMATLHQSRVMHHQEIK RSRSRIQMAPWLPEVIGGKVHSITKYFAEGSPFVKQGKYERREAGGPVRDAEQAELQRAEWRWL CRWQIAQPY*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |