Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT1G73920_circ_g.1 |
| ID in PlantcircBase | ath_circ_010057 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr1: 27792747-27792971 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | AT1G73920 |
| Parent gene annotation |
Alpha/beta-Hydrolases superfamily protein |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT1G73920.2:2 AT1G73920.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.176777852 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
27792967-27792968(+) 27792788-27792968(+) |
| Potential amino acid sequence |
MGYPYEAIRVITSDGYVLVLERIPRRDARKAVFLQHGVLDSSMGYPYEAIRVITSDGYVLVLER IPRRDARKAVFLQHGVLDSSMGYPYEAIRVITSDGYVLVLERIPRRDARKAVFLQHGVLDSSM( +) MFLSWKGYQDVMQGKLFFCSMGFWILQWGILTKLFVLLHLTDMFLSWKGYQDVMQGKLFFCSMG FWILQWGILTKLFVLLHLTDMFLSWKGYQDVMQGKLFFCSMGFWILQWGILTKLFVLLHLTDMF LSWKGYQDVMQGKLFFCSMGFWILQW(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |