Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os04g0657500_circ_g.2 |
ID in PlantcircBase | osa_circ_025751 |
Alias | Os04circ16322 |
Organism | Oryza sativa |
Position | chr4: 33530706-33530933 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, SMALT, Segemehl |
Parent gene | Os04g0657500 |
Parent gene annotation |
Lipase, class 3 family protein. (Os04t0657500-01) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 4/1 |
Tissues | leaf/shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os04t0657500-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_005810* |
PMCS | 0.436579215 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
33530873-33530708(-) |
Potential amino acid sequence |
MNASFSYATLDAMTQSAAWYRLSAGVMLLSRSTLGSMSPVIDRYDADFRSGYSILPFQQLKNWT NSICQRRVTTSRMNASFSYATLDAMTQSAAWYRLSAGVMLLSRSTLGSMSPVIDRYDADFRSGY SILPFQQLKNWTNSICQRRVTTSRMNASFSYATLDAMTQSAAWYRLSAGVMLLSRSTLGSMSPV IDRYDADFRSGYSILPFQQLKNWTNSICQRRVTTSRMNASFSYATLDAMTQSAAWYRLSAGVML LSRSTLGSMSPVIDRYDADFRSGYSIL(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Lu et al., 2015;Chu et al., 2017 |