Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0657500_circ_g.2 |
| ID in PlantcircBase | osa_circ_025751 |
| Alias | Os04circ16322 |
| Organism | Oryza sativa |
| Position | chr4: 33530706-33530933 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, SMALT, Segemehl |
| Parent gene | Os04g0657500 |
| Parent gene annotation |
Lipase, class 3 family protein. (Os04t0657500-01) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 4/1 |
| Tissues | leaf/shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os04t0657500-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_005810* |
| PMCS | 0.436579215 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
33530873-33530708(-) |
| Potential amino acid sequence |
MNASFSYATLDAMTQSAAWYRLSAGVMLLSRSTLGSMSPVIDRYDADFRSGYSILPFQQLKNWT NSICQRRVTTSRMNASFSYATLDAMTQSAAWYRLSAGVMLLSRSTLGSMSPVIDRYDADFRSGY SILPFQQLKNWTNSICQRRVTTSRMNASFSYATLDAMTQSAAWYRLSAGVMLLSRSTLGSMSPV IDRYDADFRSGYSILPFQQLKNWTNSICQRRVTTSRMNASFSYATLDAMTQSAAWYRLSAGVML LSRSTLGSMSPVIDRYDADFRSGYSIL(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015;Chu et al., 2017 |