Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0148700_circ_g.2 |
| ID in PlantcircBase | osa_circ_026569 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr5: 2787952-2788624 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os05g0148700 |
| Parent gene annotation |
Armadillo-type fold domain containing protein. (Os05t0148700-01) ;Similar to OSA15 protein. (Os05t0148700-02) |
| Parent gene strand | + |
| Alternative splicing | Os05g0148700_circ_g.1 Os05g0148700_circ_g.3 Os05g0148700_circ_g.4 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os05t0148700-02:4 Os05t0148700-01:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.186564735 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
2788599-2788020(+) |
| Potential amino acid sequence |
MEDAFMALKWHNKAEQTCVPGCCCFRVRISQA*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |