Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0610300_circ_g.3 |
| ID in PlantcircBase | osa_circ_002576 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 24142695-24142952 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | KNIFE, PcircRNA_finder, circRNA_finder, find_circ |
| Parent gene | Os01g0610300 |
| Parent gene annotation |
Bromo adjacent region domain containing protein. (Os01t0610300-0 1) |
| Parent gene strand | + |
| Alternative splicing | Os01g0610300_circ_g.2 |
| Support reads | 3 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0610300-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.204208915 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
24142757-24142705(+) |
| Potential amino acid sequence |
MMIQTMEKHMLYSKQKVPQTLLFQKLIQAWWSVEGAYT*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |