Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | scaffold8.766_circ_g.1 |
ID in PlantcircBase | ecr_circ_000758 |
Alias | NA |
Organism | Echinochloa crus-galli |
Position | chrscaffold8: 9605521-9605710 JBrowse» |
Reference genome | Echinochloa crus-galli v2 |
Type | i-circRNA |
Identification method | circseq-cup |
Parent gene | scaffold8.766 |
Parent gene annotation | NA |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf |
Exon boundary | NA-NA |
Splicing signals | CT-TA |
Number of exons covered | 0 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
9605357-9605663(-) |
Potential amino acid sequence |
MMIHLIVLGAVVGGSEEKKYLQHTYVPDHHHNTKPAKNSCLVVVPHCFTFFNHLLINKLNHIDH DDSFDCSWRCGGWVRGKKIPATYIRP* |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | NA |