Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os10g0545300_circ_g.1 |
| ID in PlantcircBase | osa_circ_007883 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr10: 21313236-21314595 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os10g0545300 |
| Parent gene annotation |
Zinc finger, CCHC retroviral-type domain containing protein. (Os 10t0545300-01) |
| Parent gene strand | - |
| Alternative splicing | Os10g0545300_circ_g.2 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os10t0545300-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_002931* |
| PMCS | 0.116132635 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
21314400-21313281(+) 21314473-21314489(-) 21314409-21314563(-) |
| Potential amino acid sequence |
MAHHGMRYAQYESCGPLVAGCGCSSSNLPSKSPSSNQTANTTPQNQHLQDSHNLLGCYNPPFFL PSLEAHMHGKEPHLDNL*(+) MSSRSPPPKDRRIRTERTSYRDAPYRRDSRRGPSRFPNDLCNNCKRPGHFARDCPNVALCHACG LPGKEGRREGCNSLTGCGSLGGAGFVVWCSQFGWSLEI*(-) MRHTGETAAVVLADFLMICATIVSVQDILLEIVQMWLFAMHVGFQGRKEEGRVVTA*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |