Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os10g0545300_circ_g.1 |
ID in PlantcircBase | osa_circ_007883 |
Alias | NA |
Organism | Oryza sativa |
Position | chr10: 21313236-21314595 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os10g0545300 |
Parent gene annotation |
Zinc finger, CCHC retroviral-type domain containing protein. (Os 10t0545300-01) |
Parent gene strand | - |
Alternative splicing | Os10g0545300_circ_g.2 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os10t0545300-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_002931* |
PMCS | 0.116132635 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
21314400-21313281(+) 21314473-21314489(-) 21314409-21314563(-) |
Potential amino acid sequence |
MAHHGMRYAQYESCGPLVAGCGCSSSNLPSKSPSSNQTANTTPQNQHLQDSHNLLGCYNPPFFL PSLEAHMHGKEPHLDNL*(+) MSSRSPPPKDRRIRTERTSYRDAPYRRDSRRGPSRFPNDLCNNCKRPGHFARDCPNVALCHACG LPGKEGRREGCNSLTGCGSLGGAGFVVWCSQFGWSLEI*(-) MRHTGETAAVVLADFLMICATIVSVQDILLEIVQMWLFAMHVGFQGRKEEGRVVTA*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |