Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0736300_circ_g.7 |
| ID in PlantcircBase | osa_circ_021700 |
| Alias | Os_ciR8819 |
| Organism | Oryza sativa |
| Position | chr3: 30183760-30184067 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os03g0736300 |
| Parent gene annotation |
Similar to CEL6=CELLULASE 6 (Fragment). (Os03t0736300-01);Simila r to Endoglucanase 10. (Os03t0736300-02) |
| Parent gene strand | - |
| Alternative splicing | Os03g0736300_circ_g.2 Os03g0736300_circ_g.3 Os03g0736300_circ_g.4 Os03g0736300_circ_g.5 Os03g0736300_circ_g.6 Os03g0736300_circ_g.8 Os03g0736300_circ_g.9 Os03g0736300_circ_g.10 Os03g0736300_circ_g.11 Os03g0736300_circ_g.12 |
| Support reads | 2/2 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0736300-02:1 Os03t0736300-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_013602 |
| PMCS | 0.41347987 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
30183848-30183814(+) 30184017-30183779(+) 30184019-30184016(-) |
| Potential amino acid sequence |
MVELTDRLILGLVLDHTPAEHGHGPGHGVVELDGVSCVVEASDQALPDGAVGEAILHARIPPPA DAVMLRQRTSCATIRSIVSADELKVLRR*(+) MQEFPLQLTPLCFGSGPAVRRSDR*(+) MKDGLSDSTVRKSLVGGFYDAGDAIKFNYPMAWSMTMLSWSVIEYKAKYEAIGELDHVKELIKW GTDYLLKTFNSSADTIDRIVAQLVRCRSITASAGGGILA*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |