Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0388100_circ_g.2 |
| ID in PlantcircBase | osa_circ_020127 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 15480478-15481652 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os03g0388100 |
| Parent gene annotation |
ATPase, P-type, K/Mg/Cd/Cu/Zn/Na/Ca/Na/H-transporter domain cont aining protein. (Os03t0388100-01);ATPase, P-type, K/Mg/Cd/Cu/Zn/ Na/Ca/Na/H-transporter domain containing protein. (Os03t0388100- 02) |
| Parent gene strand | - |
| Alternative splicing | Os03g0388100_circ_g.3 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0388100-02:2 Os03t0388100-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.104754149 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
15481651-15480629(-) |
| Potential amino acid sequence |
MSCGGCAASVKRILESQPEVTSATVDFEKKTAAVWTTPEAKATKDWRKQLGEKLSHHLSTCGFQ SHLLGDVVRWMRREREADSREPA*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |