Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.004G011600_circ_g.1 |
| ID in PlantcircBase | gra_circ_000303 |
| Alias | Chr04:829798|831120 |
| Organism | Gossypium raimondii |
| Position | chrChr04: 829798-831120 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.004G011600 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 4 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.004G011600.1:6 Gorai.004G011600.2:6 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | gar_circ_000558* |
| PMCS | 0.188492246 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
830515-831101(-) 830914-831117(-) |
| Potential amino acid sequence |
MMENDLWLMYGPWILLPSLMNGVNWNLKGKALLRACMPLQVHAQMVFFCSVEGGMRTVWTSWCH C*(-) MVVIQGGIGPAGLSAEDLHVLDLTQPRPRWHRVVVQGPGPGPRYGHVMALVGQRFLMAIGGNDG KRPLADVWALDTAAKPYEWRKLEPEGEGPPPCMYATASARSDGLLLLCGGRDANSVD*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |