Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os09g0516600_circ_g.7 |
| ID in PlantcircBase | osa_circ_039857 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr9: 20125099-20125784 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os09g0516600 |
| Parent gene annotation |
Glyoxalase II. (Os09t0516600-01);Glyoxalase II. (Os09t0516600-02 ) |
| Parent gene strand | - |
| Alternative splicing | Os09g0516600_circ_g.8 Os09g0516600_circ_g.9 Os09g0516600_circ_g.10 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os09t0516600-01:2 Os09t0516600-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.296891849 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
20125152-20125767(-) 20125156-20125690(-) |
| Potential amino acid sequence |
MFAGHQVLVMETPGHTSGTLPSR*(-) MDVCWSSSSCNGNSWSYIRYPAFKITMLTSYMMLILEQLELWTLLKQRQS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |