Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0717800_circ_g.4 |
| ID in PlantcircBase | osa_circ_032384 |
| Alias | Os_ciR10648 |
| Organism | Oryza sativa |
| Position | chr6: 30498876-30499768 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os06g0717800 |
| Parent gene annotation |
Similar to Protein phosphatase 2C-like protein. (Os06t0717800-01 );Similar to Protein phosphatase 2C-like protein. (Os06t0717800- 02);Similar to Protein phosphatase 2C. (Os06t0717800-03) |
| Parent gene strand | - |
| Alternative splicing | Os06g0717800_circ_g.1 Os06g0717800_circ_g.2 Os06g0717800_circ_g.3 Os06g0717800_circ_g.5 |
| Support reads | 2/1 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os06t0717800-01:2 Os06t0717800-03:2 Os06t0717800-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.450682867 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
30499669-30499738(-) |
| Potential amino acid sequence |
MIVTLMNLLRACWRPSSNQHARAGSDVAGRQDGLLWYKDTGQHVNGEFSMAVVQANNLLEDQCQ IESGPLSFLDSGPYGTFVGVYDGHGGPETACYINDHLFHHLKRFASEQNSISADVLKKAYEATE DGFFSVVTKQWPVKPQIAAVGSCCLVGVICGGILYVANVGDSRVVLGRHVKATGEVLAVQLSAE HNVSIESVRKELQSMHPEDRHIVVLKHNVWRVKGLIQNKGKHRRINK*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |