Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0593100_circ_g.3 |
| ID in PlantcircBase | osa_circ_031281 |
| Alias | Os_ciR10456 |
| Organism | Oryza sativa |
| Position | chr6: 23305618-23306153 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os06g0593100 |
| Parent gene annotation |
Similar to UDP-galactose/UDP-glucose transporter. (Os06t0593100- 01) |
| Parent gene strand | + |
| Alternative splicing | Os06g0593100_circ_g.2 |
| Support reads | 2/1 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os06t0593100-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.273357338 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
23305621-23306060(+) 23305674-23306106(-) |
| Potential amino acid sequence |
MLMGTILYGVKYTFPEYICTFLVAGGVSSFALLKTSSKTIKKLANPNAPLGYTLCFLNLAFDGY TNSTQDLIKSSNADGNYTVWCQVHISGVHLHLSCCWGCIILCVVEDKLQDYQEAC*(+) MYSGNVYLTPYSIVPISITRLYQILGRIGVTIKS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |