Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.004G092600_circ_g.1 |
| ID in PlantcircBase | gra_circ_000344 |
| Alias | Chr04:13088603|13091785 |
| Organism | Gossypium raimondii |
| Position | chrChr04: 13088603-13091785 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | ue-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.004G092600 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | orai.004G092500_circ_ag.1 orai.004G092600_circ_g.2 orai.004G092600_circ_g.3 |
| Support reads | 3 |
| Tissues | ovule |
| Exon boundary | No-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Gorai.004G092600.2:7 Gorai.004G092600.3:7 Gorai.004G092600.1:7 Gorai.004G092600.4:7 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | ghi_circ_000333* gar_circ_000487* ghi_circ_000113* |
| PMCS | 0.449282983 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
13088662-13088695(+) |
| Potential amino acid sequence |
MSSSRGSDQSQLMRRITRTQTAGNLGETAFDSEVVPSSLSEIAPILRVANEVESSNPRVAYLCR FYAFEKAHRLDPTSSGRGVRQFKTALLQRLERENDPTLQGRVKKSDAREMQSFYQHYYKKYIQA LTNAADKADRAQLTKAYQTANVLFEVLKAVNLTQSIEVDREILEAQDKVAEQTQILVPYNILPL DPDSANQAIMQYPEIQAAVYALRNTRGLPWPNDHKRKKDEDILDWLQEMFGFQKDNVANQREHL ILLLANVHIRRFPKPDQQPKGSECFPFYSVEILSGRRGQKCPLAGGQISHS*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |