Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0211700_circ_g.2 |
| ID in PlantcircBase | osa_circ_018472 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 5826588-5827208 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os03g0211700 |
| Parent gene annotation |
Glycoside hydrolase family 79, N-terminal protein. (Os03t0211700 -01);Similar to Heparanase-like protein 2. (Os03t0211700-02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os03t0211700-01:3 Os03t0211700-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_004627* |
| PMCS | 0.232066345 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
5826982-5826591(+) 5826663-5826605(+) |
| Potential amino acid sequence |
MVYLTPKLFCQILITIVLYYGIGLWAGKFFQLISMRRVNCVLMLIAGNSRE*(+) MQLTLQRHGTWASAWVSESGGVFNNGGELVSNTFINSIWYLDQLGMASKYNTKIFCRQTLIGGH YGLLDTQTFLPNPDYYSALLWHRLMGREVLSVDINAPRKLRAYAHCRKQQGMMPTL*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |