Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0211700_circ_g.2 |
ID in PlantcircBase | osa_circ_018472 |
Alias | NA |
Organism | Oryza sativa |
Position | chr3: 5826588-5827208 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os03g0211700 |
Parent gene annotation |
Glycoside hydrolase family 79, N-terminal protein. (Os03t0211700 -01);Similar to Heparanase-like protein 2. (Os03t0211700-02) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os03t0211700-01:3 Os03t0211700-02:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_004627* |
PMCS | 0.232066345 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
5826982-5826591(+) 5826663-5826605(+) |
Potential amino acid sequence |
MVYLTPKLFCQILITIVLYYGIGLWAGKFFQLISMRRVNCVLMLIAGNSRE*(+) MQLTLQRHGTWASAWVSESGGVFNNGGELVSNTFINSIWYLDQLGMASKYNTKIFCRQTLIGGH YGLLDTQTFLPNPDYYSALLWHRLMGREVLSVDINAPRKLRAYAHCRKQQGMMPTL*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |