Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0792500_circ_g.1 |
| ID in PlantcircBase | osa_circ_022236 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 32961312-32962054 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os03g0792500 |
| Parent gene annotation |
Similar to Zinc finger POZ domain protein (Fragment). (Os03t0792 500-01);Similar to Zinc finger POZ domain protein (Fragment). (O s03t0792500-02);Similar to Zinc finger POZ domain protein (Fragm ent). (Os03t0792500-03) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 3 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os03t0792500-02:2 Os03t0792500-01:2 Os03t0792500-03:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.436229318 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
32961416-32961376(+) |
| Potential amino acid sequence |
MDYSKPHSIHVPESDIGYHFGTLLDNQEGVDVICNVAGEKFHAHQLVLAARSSFFRSELFEHES DEEKNEVDTSNEIKEIVIDDMEPKVFKAVLHFMYRDNLVGDDELSASSSDCSIFDTLAGKLLAA ADRYELPRLRLLCESYLCKHISVNSVATTLALADRHHAMELKSVCLKFAAENLSGVIKGSFGGL LLRHRIFLKTIA*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |