Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | GLYMA_15G043600_circ_g.2 |
ID in PlantcircBase | gma_circ_003993 |
Alias | Gm15circRNA2288 |
Organism | Glycine max |
Position | chr15: 3436481-3438425 JBrowse» |
Reference genome | v2.0.38 |
Type | e-circRNA |
Identification method | Tophat, CIRI |
Parent gene | GLYMA_15G043600 |
Parent gene annotation |
hypothetical protein |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | NA |
Tissues | stem |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | KRH10351:2 |
Conservation Information | |
---|---|
Conserved circRNAs | ath_circ_044683 |
PMCS | 0.108451984 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
3438368-3436520(+) 3436573-3438387(-) 3436488-3438272(-) |
Potential amino acid sequence |
MLPLSLLRLRDPCPHPVKTGIISNQGFGQSIGT*(+) MQVEVSKHTEGSKEKMLRPNGLPESLIRYDAGFYRVRTRIPKT*(-) MMPVFTGCGHGSRRRSKDKGSIAKWENLLRKAIKLQEGWDTFLEPSHYFTHQG*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Zhao et al., 2017a |