Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | GLYMA_15G043600_circ_g.2 |
| ID in PlantcircBase | gma_circ_003993 |
| Alias | Gm15circRNA2288 |
| Organism | Glycine max |
| Position | chr15: 3436481-3438425 JBrowse» |
| Reference genome | v2.0.38 |
| Type | e-circRNA |
| Identification method | Tophat, CIRI |
| Parent gene | GLYMA_15G043600 |
| Parent gene annotation |
hypothetical protein |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | stem |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | KRH10351:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | ath_circ_044683 |
| PMCS | 0.108451984 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
3438368-3436520(+) 3436573-3438387(-) 3436488-3438272(-) |
| Potential amino acid sequence |
MLPLSLLRLRDPCPHPVKTGIISNQGFGQSIGT*(+) MQVEVSKHTEGSKEKMLRPNGLPESLIRYDAGFYRVRTRIPKT*(-) MMPVFTGCGHGSRRRSKDKGSIAKWENLLRKAIKLQEGWDTFLEPSHYFTHQG*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017a |