Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0295100_circ_g.4 |
| ID in PlantcircBase | osa_circ_027266 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr5: 13032118-13033763 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os05g0295100 |
| Parent gene annotation |
Hypothetical conserved gene. (Os05t0295100-01);Protein of unknow n function DUF1253 family protein. (Os05t0295100-02) |
| Parent gene strand | + |
| Alternative splicing | Os05g0295100_circ_g.1 Os05g0295100_circ_g.2 Os05g0295100_circ_g.3 Os05g0295100_circ_g.5 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os05t0295100-02:4 Os05t0295100-01:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.1024734 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
13032139-13032118(+) 13032161-13033682(-) 13032145-13033624(-) |
| Potential amino acid sequence |
MHCNKKPFYLKGGSTVDSSTMDSYLMHALNHINRTREIVVKNDAKLRSDPSKDILDDNSFLDQG FTRPKVLFLLPLKSIARRVVKRLIQLSPLSQKDIIAKFEGKFGESDDEVEEPVQSNKPADFDLL FAGDTDDEFLFGIKYTK*(+) MASYYNALCHDSYYFVYFIPKRNSSSVSPANSRSKSAGLLL*(-) MHYVTIATTLYILSQKGTHHQYLQQTVGQSLQVYYFEQAPLLHHLIRQTSLRILQ*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |