Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Solyc04g076790.2_circ_g.1 |
| ID in PlantcircBase | sly_circ_001522 |
| Alias | NA |
| Organism | Solanum lycopersicum |
| Position | chr4: 61674066-61674912 JBrowse» |
| Reference genome | SL2.50.38 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Solyc04g076790.2 |
| Parent gene annotation |
Serine hydroxymethyltransferase 2, mitochondrial |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | fruit |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Solyc04g076790.2.1:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.205085842 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
61674070-61674073(+) 61674878-61674073(+) |
| Potential amino acid sequence |
MYDYEDKINQAVFPGLQGGPHNHTISGLAVALKQVMTPEYKAYQEQVLSNCSKFAESLLAAGYD LVSGGTENHLVLVNLRNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGYV*(+) MYLPWYLVAFAWVMYDYEDKINQAVFPGLQGGPHNHTISGLAVALKQVMTPEYKAYQEQVLSNC SKFAESLLAAGYDLVSGGTENHLVLVNLRNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPG GIRMGYV*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zuo et al., 2016 |