Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT4G31880_circ_g.1 |
ID in PlantcircBase | ath_circ_033930 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr4: 15420571-15420857 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | AT4G31880 |
Parent gene annotation |
Putative uncharacterized protein At4g31880 |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT4G31880.2:2 AT4G31880.1:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.15109547 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
15420810-15420573(-) |
Potential amino acid sequence |
MDQAYYKGVVESYDAAKKKHLASGESLVGSRIKVWWPMDQAYYKGVVESYDAAKKKHLASGESL VGSRIKVWWPMDQAYYKGVVESYDAAKKKHLASGESLVGSRIKVWWPMDQAYYKGVVESYDAAK KKHL(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |