Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT4G31880_circ_g.1 |
| ID in PlantcircBase | ath_circ_033930 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr4: 15420571-15420857 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | AT4G31880 |
| Parent gene annotation |
Putative uncharacterized protein At4g31880 |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT4G31880.2:2 AT4G31880.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.15109547 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
15420810-15420573(-) |
| Potential amino acid sequence |
MDQAYYKGVVESYDAAKKKHLASGESLVGSRIKVWWPMDQAYYKGVVESYDAAKKKHLASGESL VGSRIKVWWPMDQAYYKGVVESYDAAKKKHLASGESLVGSRIKVWWPMDQAYYKGVVESYDAAK KKHL(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |