Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0773200_circ_g.6 |
ID in PlantcircBase | osa_circ_004145 |
Alias | Os_ciR4502 |
Organism | Oryza sativa |
Position | chr1: 32680553-32681100 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer, KNIFE, PcircRNA_finder, find_circ |
Parent gene | Os01g0773200 |
Parent gene annotation |
Hypothetical conserved gene. (Os01t0773200-01);Conserved hypothe tical protein. (Os01t0773200-02) |
Parent gene strand | - |
Alternative splicing | Os01g0773200_circ_g.5 |
Support reads | 4/2 |
Tissues | root/shoot, root, seed |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os01t0773200-02:3 Os01t0773200-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_002440* osi_circ_010781 |
PMCS | 0.217220119 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
32680945-32680623(+) 32680869-32680866(-) |
Potential amino acid sequence |
MVRKQDIFPTVSSCELDRDRRRDRSKPANSQGRHGEDPTERRPSNPSPRHETLVLNRLGHNSLS CSSTPPLKKRAP*(+) MMSSTGHVFYGDLRSHERAGFFTLNLLGSCNFHHFARGANAAYLAPRFQVLVPFSKFMNSCKSY LRCPNASSDSPKAQEILKEPASSEEGCSSSLESCDQVYLAQVFRGVVKDWTASSRWDPRRGGLD YLRVWIDPSFYLYLAHMRRQWERYLVSVPFYFALCNLRYSIYFRKRLDLMLMWKL*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |