Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0773200_circ_g.6 |
| ID in PlantcircBase | osa_circ_004145 |
| Alias | Os_ciR4502 |
| Organism | Oryza sativa |
| Position | chr1: 32680553-32681100 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer, KNIFE, PcircRNA_finder, find_circ |
| Parent gene | Os01g0773200 |
| Parent gene annotation |
Hypothetical conserved gene. (Os01t0773200-01);Conserved hypothe tical protein. (Os01t0773200-02) |
| Parent gene strand | - |
| Alternative splicing | Os01g0773200_circ_g.5 |
| Support reads | 4/2 |
| Tissues | root/shoot, root, seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0773200-02:3 Os01t0773200-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_002440* osi_circ_010781 |
| PMCS | 0.217220119 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
32680945-32680623(+) 32680869-32680866(-) |
| Potential amino acid sequence |
MVRKQDIFPTVSSCELDRDRRRDRSKPANSQGRHGEDPTERRPSNPSPRHETLVLNRLGHNSLS CSSTPPLKKRAP*(+) MMSSTGHVFYGDLRSHERAGFFTLNLLGSCNFHHFARGANAAYLAPRFQVLVPFSKFMNSCKSY LRCPNASSDSPKAQEILKEPASSEEGCSSSLESCDQVYLAQVFRGVVKDWTASSRWDPRRGGLD YLRVWIDPSFYLYLAHMRRQWERYLVSVPFYFALCNLRYSIYFRKRLDLMLMWKL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |