Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | LOC18031276_circ_g.1 |
| ID in PlantcircBase | ptr_circ_000523 |
| Alias | circRNA525 |
| Organism | Poncirus trifoliata |
| Position | chrNW_006261964.1: 4472648-4474624 JBrowse» |
| Reference genome | Citrus_clementina_v1.0 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | LOC18031276 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | shoots |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | XM_006420020.2:6 XM_006420021.2:6 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
4474194-4474597(-) |
| Potential amino acid sequence |
MKIPVKGVSANLTKGAQKPFEAIFVSSSHKKDCSCDPLIVVLHGGPHSVSLSSYSKSLAFLSSV GYSLLIVNYRGSLGCGEEALQSLPGKVGSQDVNDVLTAIDHVIDTGLANPSKVTVVGGSHGGFL TTHLIGQWRVIAYHPC*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | playing an important role in the early flowering process |
| Other Information | |
|---|---|
| References | Zeng et al., 2018 |