Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT1G21580_circ_g.1 |
ID in PlantcircBase | ath_circ_003776 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr1: 7558475-7558686 JBrowse» |
Reference genome | TAIR10.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer |
Parent gene | AT1G21580 |
Parent gene annotation |
Zinc finger C-x8-C-x5-C-x3-H type family protein |
Parent gene strand | - |
Alternative splicing | AT1G21580_circ_g.2 AT1G21580_circ_g.3 AT1G21580_circ_g.4 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT1G21580.7:1 AT1G21580.6:2 AT1G21580.3:2 AT1G21580.1:2 AT1G21580.5:1 AT1G21580.4:2 AT1G21580.2:1 AT1G21580.8:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.209119966 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
7558672-7558477(-) |
Potential amino acid sequence |
MPDCSYYLQGLCNNEACPYRHVHVNPIAPICDGFLKGYCSEGDEVIPERMPDCSYYLQGLCNNE ACPYRHVHVNPIAPICDGFLKGYCSEGDEVIPERMPDCSYYLQGLCNNEACPYRHVHVNPIAPI CDGFLKGYCSEGDEVIPERMPDCSYYLQGLCNNEACPYRHVHVNPIAPICDGFLKGYCSEGDE( -) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |