Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT1G21580_circ_g.1 |
| ID in PlantcircBase | ath_circ_003776 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr1: 7558475-7558686 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | AT1G21580 |
| Parent gene annotation |
Zinc finger C-x8-C-x5-C-x3-H type family protein |
| Parent gene strand | - |
| Alternative splicing | AT1G21580_circ_g.2 AT1G21580_circ_g.3 AT1G21580_circ_g.4 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT1G21580.7:1 AT1G21580.6:2 AT1G21580.3:2 AT1G21580.1:2 AT1G21580.5:1 AT1G21580.4:2 AT1G21580.2:1 AT1G21580.8:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.209119966 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
7558672-7558477(-) |
| Potential amino acid sequence |
MPDCSYYLQGLCNNEACPYRHVHVNPIAPICDGFLKGYCSEGDEVIPERMPDCSYYLQGLCNNE ACPYRHVHVNPIAPICDGFLKGYCSEGDEVIPERMPDCSYYLQGLCNNEACPYRHVHVNPIAPI CDGFLKGYCSEGDEVIPERMPDCSYYLQGLCNNEACPYRHVHVNPIAPICDGFLKGYCSEGDE( -) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |