Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0489525_circ_g.4 |
| ID in PlantcircBase | osa_circ_014694 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 17050756-17050852 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os02g0489550 |
| Parent gene annotation |
Tetratricopeptide TPR-1 domain containing protein. (Os02t0489550 -00) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os02t0489525-00:1 Os02t0489550-00:1 Os02t0489525-00:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.121134021 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
17050766-17050826(+) |
| Potential amino acid sequence |
MQKVAGCFRKIRTQTKSLFIANYSRFNMSTVKYAKGCRLLQENQDANEEPVYS*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |