Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Gh_A02G0766_circ_g.1 |
| ID in PlantcircBase | ghi_circ_000202 |
| Alias | A02:14935854|14937954 |
| Organism | Gossypium hirsutum |
| Position | chrA02: 14935854-14937954 JBrowse» |
| Reference genome | v1.1 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gh_A02G0766 |
| Parent gene annotation |
SIMILAR TO: AT2G17900, SET domain group 37 |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 3 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Gh_A02G0766:6 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | gar_circ_000342* gra_circ_000463* |
| PMCS |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
14937952-14936089(+) |
| Potential amino acid sequence |
MLPEELALSDNALISLAIFLISSLFLMRPHCWQTNPFSSDSLSKKPLHPLSLHR*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |