Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d043703_circ_g.1 |
| ID in PlantcircBase | zma_circ_007815 |
| Alias | zma_circ_0001318 |
| Organism | Zea mays |
| Position | chr3: 207880807-207881978 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | u-circRNA |
| Identification method | find_circ |
| Parent gene | Zm00001d043703 |
| Parent gene annotation |
Anoctamin-like protein |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | leaf, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Zm00001d043703_T006:3 Zm00001d043703_T010:4 Zm00001d043703_T002:4 Zm00001d043703_T009:4 Zm00001d043703_T001:4 Zm00001d043703_T008:3 Zm00001d043703_T003:2 Zm00001d043703_T007:4 Zm00001d043703_T004:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.063428072 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
207881951-207880855(+) 207881017-207881946(-) |
| Potential amino acid sequence |
MRFTPTLEQSWLHQWGPWGELLLICR*(+) MLRPGPIEIEAPFRCRLAFSSAYQQQLSPGSPLVQPALFQSRSKSHQ*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ma et al., 2021b |