Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d043703_circ_g.1 |
ID in PlantcircBase | zma_circ_007815 |
Alias | zma_circ_0001318 |
Organism | Zea mays |
Position | chr3: 207880807-207881978 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | find_circ |
Parent gene | Zm00001d043703 |
Parent gene annotation |
Anoctamin-like protein |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d043703_T006:3 Zm00001d043703_T010:4 Zm00001d043703_T002:4 Zm00001d043703_T009:4 Zm00001d043703_T001:4 Zm00001d043703_T008:3 Zm00001d043703_T003:2 Zm00001d043703_T007:4 Zm00001d043703_T004:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.063428072 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
207881951-207880855(+) 207881017-207881946(-) |
Potential amino acid sequence |
MRFTPTLEQSWLHQWGPWGELLLICR*(+) MLRPGPIEIEAPFRCRLAFSSAYQQQLSPGSPLVQPALFQSRSKSHQ*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b |