Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | GLYMA_15G215900_circ_g.1 |
| ID in PlantcircBase | gma_circ_009342 |
| Alias | gma_circ_0000544 |
| Organism | Glycine max |
| Position | chr15: 35365065-35367804 JBrowse» |
| Reference genome | v2.0.38 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | GLYMA_15G215900 |
| Parent gene annotation |
hypothetical protein |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | KRH13101:7 KRH13102:7 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.011260109 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
35366919-35367801(-) |
| Potential amino acid sequence |
MKYIDIWINNAGSNAYSYKPLVEASDEDLIEVVTTNTLGLMICCREAIKMMVNQPRGGHIFNID GAGSDGRPTPRFAAYGATKRSVVHLTKSLQE*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Wang et al., 2020 |