Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0301300_circ_g.1 |
| ID in PlantcircBase | osa_circ_030621 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr6: 11266554-11267509 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os06g0301300 |
| Parent gene annotation |
Similar to predicted protein. (Os06t0301300-00) |
| Parent gene strand | + |
| Alternative splicing | Os06g0301300_circ_igg.1 Os06g0301300_circ_igg.2 Os06g0301300_circ_igg.3 Os06g0301300_circ_igg.2 Os06g0301300_circ_igg.3 Os06g0301300_circ_igg.4 Os06g0301300_circ_ig.1 Os06g0301300_circ_ig.2 Os06g0301300_circ_ig.3 Os06g0301300_circ_ig.4 Os06g0301300_circ_ig.5 Os06g0301300_circ_ig.6 Os06g0301300_circ_ig.7 Os06g0301300_circ_ig.8 Os06g0301300_circ_ig.9 Os06g0301300_circ_ig.10 Os06g0301300_circ_ig.11 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os06t0301300-00:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.142837631 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
11266750-11266584(+) |
| Potential amino acid sequence |
MGPEGWKVRQQHFETVTSLVRASRSLFPEGAAAEIWSEFSPLLKNPWHNSAFEGIGFLRLFLPA NSRNQDHFTTLSGEACSSGF*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |