Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.010G096300_circ_g.1 |
| ID in PlantcircBase | gra_circ_001104 |
| Alias | Chr10:16011419|16012288 |
| Organism | Gossypium raimondii |
| Position | chrChr10: 16011419-16012288 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.010G096300 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 7 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.010G096300.1:4 Gorai.010G096300.5:4 Gorai.010G096300.2:4 Gorai.010G096300.3:4 Gorai.010G096300.4:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.108050029 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
16011448-16012217(-) 16012243-16012217(-) |
| Potential amino acid sequence |
MPCVSSCGERDLSNNHLSGVIPRELMQLQNLFSLRLENNNLSGDVMSLVNCLSLTILNVSYNNL AGDIPTSNNFSRFSPDSFIGNPGLCGYCLSSPCHVSHPAERETFQIIIYQVSFLGNSCSFRICS H*(-) MQLQNLFSLRLENNNLSGDVMSLVNCLSLTILNVSYNNLAGDIPTSNNFSRFSPDSFIGNPGLC GYCLSSPCHVSHPAERETFQIIIYQVSFLGNSCSFRICSH*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |