Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d022343_circ_g.1 |
ID in PlantcircBase | zma_circ_009493 |
Alias | zma_circ_0002668 |
Organism | Zea mays |
Position | chr7: 175902926-175905207 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | find_circ |
Parent gene | Zm00001d022343 |
Parent gene annotation |
Putative peptidase C48 domain family protein |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d022343_T005:3 Zm00001d022343_T014:2 Zm00001d022343_T006:3 Zm00001d022343_T009:3 Zm00001d022343_T008:3 Zm00001d022343_T001:3 Zm00001d022343_T003:3 Zm00001d022343_T012:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.136078974 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
175904118-175902942(+) 175903037-175903979(+) |
Potential amino acid sequence |
MCRLLILVLMCINSRVQCRINHQIITFQKGQGHLLCPTRMLMARKLMLILVEILEGQPYHP*(+ ) MAWNKEDPLFENGSLQSSEQLRMRPSENMRSQTSTKSPSNIASKFRHPSDFQDHHHVQIVDPRA NVYKFTGSMQNQSSDHNISKRSRSPTLSYEDADGTKAHVNTGGNSRRPAIPSVSRSFNPLISSR NRAPSPVSNMRTDSPADYDNGMEQRRPIV*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b |